Loading...
Statistics
Advertisement

Hoedown Time
www.thefamcards.com/
Line dancing

Thefamcards.com

Domain is redirected to: Hoedowntime.com
Advertisement
Thefamcards.com is hosted in United States . Thefamcards.com doesn't use HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Google Font API, Html, Number of used javascripts: 6. First javascripts: Modernizr-old.js, Require.js, Jquery.min.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Webs.com/1.0.

Technologies in use by Thefamcards.com

Technology

Number of occurences: 6
  • CSS
  • Google Font API
  • Html
  • Html5
  • Iframe
  • Javascript

Advertisement

Javascripts

Number of occurences: 6
  • modernizr-old.js
  • require.js
  • jquery.min.js
  • bootstrap.js
  • view.app.js
  • collector.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Webs.com/1.0

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Thefamcards.com

Missing HTTPS protocol.

    Meta - Thefamcards.com

    Number of occurences: 5
    • Name:
      Content: Hoedown Time
    • Name: title
      Content: Hoedown Time
    • Name: description
      Content: Line dancing
    • Name: keywords
      Content:
    • Name: fw:category
      Content: 0

    Server / Hosting

    • IP: 75.98.17.66
    • Latitude: 37.75
    • Longitude: -97.82
    • Country: United States

    Rname

    • ns1.freewebs.com
    • ns2.freewebs.com
    • ns2.webs.com
    • ns1.webs.com
    • sitemail.everyone.net

    Target

    • root.webs.com

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Location: http://www.hoedowntime.com/ Content-Length: 0 Date: Thu, 01 Sep 2016 00:31:21 GMT Server: Webs.com/1.0 X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Set-Cookie: fwww=70b6afb4e9427fbea0edf09bc50fc3d7e7e2ddaf3fba4bba80db2d95060c5884; Path=/ X-UA-Compatible: IE=edge,chrome=1 Content-Type: text/html;charset=UTF-8 Date: Thu, 01 Sep 2016 00:31:22 GMT Server: Webs.com/1.0 X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Transfer-Encoding: chunked Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive

    DNS

    host: thefamcards.com
    1. class: IN
    2. ttl: 10800
    3. type: A
    4. ip: 75.98.17.37
    host: thefamcards.com
    1. class: IN
    2. ttl: 10800
    3. type: NS
    4. target: ns1.freewebs.com
    host: thefamcards.com
    1. class: IN
    2. ttl: 10800
    3. type: NS
    4. target: ns2.freewebs.com
    host: thefamcards.com
    1. class: IN
    2. ttl: 10800
    3. type: NS
    4. target: ns2.webs.com
    host: thefamcards.com
    1. class: IN
    2. ttl: 10800
    3. type: NS
    4. target: ns1.webs.com
    host: thefamcards.com
    1. class: IN
    2. ttl: 10800
    3. type: SOA
    4. mname: ns1.webs.com
    5. rname: root.webs.com
    6. serial: 2013520102
    7. refresh: 10800
    8. retry: 3600
    9. expire: 1814400
    10. minimum-ttl: 3600
    host: thefamcards.com
    1. class: IN
    2. ttl: 10800
    3. type: MX
    4. pri: 0
    5. target: sitemail.everyone.net

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.hefamcards.com, www.tqhefamcards.com, www.qhefamcards.com, www.tahefamcards.com, www.ahefamcards.com, www.t hefamcards.com, www. hefamcards.com, www.twhefamcards.com, www.whefamcards.com, www.tehefamcards.com, www.ehefamcards.com, www.tzhefamcards.com, www.zhefamcards.com, www.txhefamcards.com, www.xhefamcards.com, www.tchefamcards.com, www.chefamcards.com, www.tefamcards.com, www.theefamcards.com, www.teefamcards.com, www.thdefamcards.com, www.tdefamcards.com, www.thcefamcards.com, www.tcefamcards.com, www.thuefamcards.com, www.tuefamcards.com, www.thjefamcards.com, www.tjefamcards.com, www.thefamcards.com, www.tefamcards.com, www.thbefamcards.com, www.tbefamcards.com, www.thgefamcards.com, www.tgefamcards.com, www.thfamcards.com, www.thexfamcards.com, www.thxfamcards.com, www.thesfamcards.com, www.thsfamcards.com, www.thewfamcards.com, www.thwfamcards.com, www.therfamcards.com, www.thrfamcards.com, www.theffamcards.com, www.thffamcards.com, www.thevfamcards.com, www.thvfamcards.com, www.thecfamcards.com, www.thcfamcards.com, www.theqfamcards.com, www.thqfamcards.com, www.theafamcards.com, www.thafamcards.com, www.theyfamcards.com, www.thyfamcards.com, www.theamcards.com, www.thefqamcards.com, www.theqamcards.com, www.thefamcards.com, www.theamcards.com, www.thefaamcards.com, www.theaamcards.com, www.thefyamcards.com, www.theyamcards.com, www.theftamcards.com, www.thetamcards.com, www.thefgamcards.com, www.thegamcards.com, www.thefbamcards.com, www.thebamcards.com, www.thefwamcards.com, www.thewamcards.com, www.thefsamcards.com, www.thesamcards.com, www.thefdamcards.com, www.thedamcards.com, www.theframcards.com, www.theramcards.com, www.thef3amcards.com, www.the3amcards.com, www.thef4amcards.com, www.the4amcards.com, www.thefmcards.com, www.thefaomcards.com, www.thefomcards.com, www.thefapmcards.com, www.thefpmcards.com, www.thefa9mcards.com, www.thef9mcards.com, www.thefamcards.com, www.thefmcards.com, www.thefaimcards.com, www.thefimcards.com, www.thefaumcards.com, www.thefumcards.com, www.thefacards.com, www.thefampcards.com, www.thefapcards.com, www.thefamocards.com, www.thefaocards.com, www.thefamicards.com, www.thefaicards.com, www.thefamkcards.com, www.thefakcards.com, www.thefam.cards.com, www.thefa.cards.com, www.thefamucards.com, www.thefaucards.com, www.thefamjcards.com, www.thefajcards.com, www.thefamncards.com, www.thefancards.com, www.thefam-cards.com, www.thefa-cards.com, www.thefamards.com, www.thefamcdards.com, www.thefamdards.com, www.thefamcrards.com, www.thefamrards.com, www.thefamctards.com, www.thefamtards.com, www.thefamcvards.com, www.thefamvards.com, www.thefamcfards.com, www.thefamfards.com, www.thefamcgards.com, www.thefamgards.com, www.thefamchards.com, www.thefamhards.com, www.thefamcnards.com, www.thefamnards.com, www.thefamcmards.com, www.thefammards.com, www.thefamcjards.com, www.thefamjards.com, www.thefamcrds.com, www.thefamcaords.com, www.thefamcords.com, www.thefamcaprds.com, www.thefamcprds.com, www.thefamca9rds.com, www.thefamc9rds.com, www.thefamcards.com, www.thefamcrds.com, www.thefamcairds.com, www.thefamcirds.com, www.thefamcaurds.com, www.thefamcurds.com, www.thefamcads.com, www.thefamcarids.com, www.thefamcaids.com, www.thefamcarods.com, www.thefamcaods.com, www.thefamcarlds.com, www.thefamcalds.com, www.thefamcarlds.com, www.thefamcalds.com, www.thefamcar.ds.com, www.thefamca.ds.com, www.thefamcars.com, www.thefamcardts.com, www.thefamcarts.com, www.thefamcardgs.com, www.thefamcargs.com, www.thefamcardbs.com, www.thefamcarbs.com, www.thefamcardxs.com, www.thefamcarxs.com, www.thefamcardss.com, www.thefamcarss.com, www.thefamcardfs.com, www.thefamcarfs.com, www.thefamcardvs.com, www.thefamcarvs.com, www.thefamcardys.com, www.thefamcarys.com, www.thefamcardzs.com, www.thefamcarzs.com, www.thefamcardas.com, www.thefamcaras.com, www.thefamcardes.com, www.thefamcares.com, www.thefamcardrs.com, www.thefamcarrs.com,

    Other websites we recently analyzed

    1. avalonspb.ru - Diese Website steht zum Verkauf! - Informationen zum Thema webarchiv.
      Diese Website steht zum Verkauf! avalonspb.ru ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf avalonspb.ru alles. Wir hoffen, dass Sie hier das Gesuchte finden!
      Germany - 82.98.86.164
      Server software: Apache/2.2.22 (Debian)
      Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 4
      Number of meta tags: 5
    2. DrinK.TeaM
      Team de poivrons - Have a drink
      France - 91.121.119.173
      Server software: Apache
      Technology: Html, Iframe, Javascript, Php, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 5
    3. media-magnat.com
      Ukraine - 91.200.40.52
      Server software: nginx/1.2.1
      Technology: Html
    4. sriswamisamarthvishwakalyankendra.org
      Santa Ana (United States) - 107.6.45.89
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 8
      Number of meta tags: 2
    5. Home
      Germany - 82.165.217.52
      Server software: Apache
      Technology: CSS, Html, Html5, Iframe, Javascript, Php, Facebook Box, Twitter Button
      Number of Javascript: 2
      Number of meta tags: 2
    6. Welcome to buahkaleng.com
      Welcome to buahkaleng.com
      Miami (United States) - 104.238.136.38
      Server software: nginx
      Technology: Google Adsense, Javascript, Php
      Number of Javascript: 5
      Number of meta tags: 4
    7. Финансовый портал – кредиты, ипотека, кредитные карты
      Финансовый портал – кредиты, ипотека, кредитные карты
      Russian Federation - 80.78.250.26
      Server software: nginx
      Technology: CSS, Google Font API, Html, Javascript, jQuery, MooTools, Php, Yandex.Metrika, Google Analytics
      Number of Javascript: 4
      Number of meta tags: 4
    8. huyan.com
      New York (United States) - 69.172.201.208
      Server software: DOSarrest
      Technology: Html, Javascript
      Number of meta tags: 1
    9. Home - Aeka Biochemicals Pvt. Ltd.
      Orlando (United States) - 184.171.254.44
      G Analytics ID: UA-53264454-1
      Server software: Apache
      Technology: CSS, Flexslider, Google Font API, Html, Html5, Javascript, Lightbox, Php, Pingback, Google Analytics, Wordpress, Facebook Box
      Number of Javascript: 15
      Number of meta tags: 5
    10. semprul.xyz
      Chicago (United States) - 184.154.68.125
      Server software:
      Technology: Html
      Number of meta tags: 1

    Check Other Websites